PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000219581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 580aa    MW: 63445.3 Da    PI: 8.2006
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000219581genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-1183122848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +de l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
    MDP0000219581  83 LDETLRNAVAAFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 122
                      79***********************.************986 PP

2Myb_DNA-binding62.77.4e-20128174148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++++++v+++G+  W++Ia+ ++ gR +kqc++rw+++l
    MDP0000219581 128 KGPWTQEEDDKIIELVAKYGPTKWSLIAKSLP-GRIGKQCRERWHNHL 174
                      79******************************.*************97 PP

3Myb_DNA-binding55.51.3e-17180223146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      + +WT eE++ l +a++++G++ W+ Ia+ ++ gRt++ +k++w++
    MDP0000219581 180 KEAWTLEEELALMKAHQMHGNK-WAEIAKVLP-GRTDNAIKNHWNS 223
                      579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.82854122IPR017877Myb-like domain
SMARTSM007172.3E-558124IPR001005SANT/Myb domain
CDDcd001671.04E-862122No hitNo description
PfamPF002499.2E-1083122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-1584128IPR009057Homeodomain-like
SuperFamilySSF466896.82E-1084132IPR009057Homeodomain-like
PROSITE profilePS5129433.49123178IPR017930Myb domain
SuperFamilySSF466892.88E-32125221IPR009057Homeodomain-like
SMARTSM007176.7E-19127176IPR001005SANT/Myb domain
PfamPF002492.8E-19128174IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-28129177IPR009057Homeodomain-like
CDDcd001674.65E-17130174No hitNo description
Gene3DG3DSA:1.10.10.604.1E-24178229IPR009057Homeodomain-like
SMARTSM007171.3E-16179227IPR001005SANT/Myb domain
PROSITE profilePS5129423.071179229IPR017930Myb domain
PfamPF002493.6E-16180223IPR001005SANT/Myb domain
CDDcd001677.88E-13182225No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 580 aa     Download sequence    Send to blast
MAGAKLEECC LENKQSMATS SSSVSEGSGS AIIKSPGACS PASASPTQRR TSGPIRRAKG  60
GWTPQELEAC TFFVFVTGGR GSLDETLRNA VAAFKGKSWK KIAEFFPDRS EVQCLHRWQK  120
VLNPELVKGP WTQEEDDKII ELVAKYGPTK WSLIAKSLPG RIGKQCRERW HNHLNPDIKK  180
EAWTLEEELA LMKAHQMHGN KWAEIAKVLP GRTDNAIKNH WNSSLKKKLD FYLATGKLPP  240
PPKYGAKEPR SNATKKILVR STKGSDSTAQ TSSGNAXMSK LDEDGKDQFE SAAPPQDMGA  300
SSSVHPNECA DSEGVECDLR LSFMDLSCSN SDSGPKFDNF GVKRKPQIEN SVSNGRAESE  360
NCGFSNQMDE DSVKTTSFPF ETPRYGSLYY EPPPLESSVQ FNSGFSSMHR LQNDYTSSPN  420
LSPISFFTPP CVKGSGLCNQ SPESILKIAA KTFPNTPSIL RKRKTIGQGX XPCXKVAVVD  480
CESVREMLNV SSEHKNSAEV SGSQDGSLCE SPTSNGKAFN ASPPYRLRAR RTAVFKSVEK  540
QLEFTCDEEY DANSMSVELS ANGGSAVIKD CTHPTKMAVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-688422914159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-688422914159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.159980.0bud| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744600.0DQ074460.1 Malus x domestica MYB4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008366798.10.0PREDICTED: uncharacterized protein LOC103430441
TrEMBLQ2LMF20.0Q2LMF2_MALDO; MYB4
STRINGVIT_08s0007g00360.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-150myb domain protein 3r-5
Publications ? help Back to Top
  1. Hellens RP, et al.
    Transient expression vectors for functional genomics, quantification of promoter activity and RNA silencing in plants.
    Plant Methods, 2005. 1: p. 13
    [PMID:16359558]